Rat CD8a Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86119-1-RR (same clone as 86119-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86119-1-RR (CD8a antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86119-1-PBS in a different storage buffer formulation.

CD8a Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86119-1-PBS

Clone No.250721F4

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

WB, Indirect ELISA

Synonyms

CD8, CD8 antigen 32 kDa chain, CD8a molecule, OX-8 membrane antigen, T-cell surface glycoprotein CD8 alpha chain

---

Product Information

86119-1-PBS targets CD8a in WB, Indirect ELISA applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3839

  Product name: Recombinant Rat CD8A protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 27-189 aa of NM_031538.2

  Sequence: QLQLSPKKVDAEIGQEVKLTCEVLRDTSQGCSWLFRNSSSELLQPTFIIYVSSSRSKLNDILDPNLFSARKENNKYILTLSKFSTKNQGYYFCSITSNSVMYFSPLVPVFQKVNSIITKPVTRAPTPVPPPTGTPRPLRPEACRPGASGSVEGMGLGFACDIY

• Full Name: CD8a molecule
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: NM_031538.2
• Gene Symbol: Cd8a
• Gene ID (NCBI): 24930
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07725
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD8 is a transmembrane glycoprotein composed of two disulfide-linked chains. It can be present as a homodimer of CD8α or as a heterodimer of CD8α and CD8β (PMID: 3264320; 8253791). CD8 is found on most thymocytes. The majority of class I-restricted T cells express mostly the CD8αβ heterodimer while CD8αα homodimers alone have been found on some gut intraepithelial T cells, on some T cell receptor (TCR) γδ T cells and on NK cells (PMID: 2111591; 1831127; 8420975). CD8 acts as a co-receptor that binds to MHC class-I and participates in cytotoxic T cell activation (PMID: 8499079). During T cell development, CD8 is required for positive selection of CD4-/CD8+ T cells (PMID: 1968084).