Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CD9 Monoclonal antibody

CD9 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 60232-1-Ig
Clone No.4H7B9

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IF-P, ELISA, PLA

CD9 antigen, BTCC 1, BA2, 5H9 antigen, 5H9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, HeLa cells
Positive IHC detected inhuman ovary tumor tissue, human breast cancer tissue, human colon cancer tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman breast cancer tissue, human ovary tumor tissue, human lung cancer tissue
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60232-1-Ig targets CD9 in WB, IHC, IF/ICC, IF-P, ELISA, PLA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14529

Product name: Recombinant human CD9 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 100-208 aa of BC011988

Sequence: FAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMI

Predict reactive species
Full Name CD9 molecule
Calculated Molecular Weight 228 aa, 25 kDa
Observed Molecular Weight 23-27 kDa
GenBank Accession NumberBC011988
Gene Symbol CD9
Gene ID (NCBI) 928
RRIDAB_11232215
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP21926
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405). CD9 is also known as the p24 antigen besides MIC3, TSPAN29 because it is a protein of molecular weight 24 kD. The CD9 antigen appears to be a 227-amino acid molecule with 4 hydrophobic domains and 1 N-glycosylation site.

Protocols

Product Specific Protocols
IF protocol for CD9 antibody 60232-1-IgDownload protocol
IHC protocol for CD9 antibody 60232-1-IgDownload protocol
WB protocol for CD9 antibody 60232-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Nat Commun

A functionally tunable magnetic nanochains platform for N-glycoproteomic analysis of extracellular vesicles from ultratrace biofluids

Authors - Mingyang Li

Transl Neurodegener

Abnormal α-synuclein binds to synaptotagmin 13, impairing extracellular vesicle release in synucleinopathies

Authors - Yasuo Miki
humanWB

Brain

Extracellular vesicle biomarkers for complement dysfunction in schizophrenia

Authors - Ting Xue
humanWB

J Extracell Vesicles

124I-labelled BMSC-Derived Extracellular Vesicles Deliver CRISPR/Cas9 Ribonucleoproteins With a GFP-Reporter System to Inhibit Osteosarcoma Proliferation and Metastasis

Authors - Yujie Pan
humanWB

Adv Sci (Weinh)

Cancer Cell-Derived Large Extracellular Vesicles Promote Venous Thromboembolism by Activating NETosis Through Delivering CYBA

Authors - Xiangji Li

Adv Sci (Weinh)

POSTN-Mediated Interplay of M1 Polarized Macrophage with Tendon-Derived Stem Cells to Drive Traumatic Heterotopic Ossification Formation through PTK7/ATK Signaling

Authors - Hang Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Guorong (Verified Customer) (03-22-2022)

Very weak bands with strong background were detected at 25 kDa

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: ARPE-19
CD9 Antibody Western Blot validation (1:5000 dilution) in ARPE-19 (Cat no:60232-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...