Tested Applications
| Positive WB detected in | A431 cells, HeLa cells |
| Positive IHC detected in | human ovary tumor tissue, human breast cancer tissue, human colon cancer tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human breast cancer tissue, human ovary tumor tissue, human lung cancer tissue |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60232-1-Ig targets CD9 in WB, IHC, IF/ICC, IF-P, ELISA, PLA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rabbit |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14529 Product name: Recombinant human CD9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 100-208 aa of BC011988 Sequence: FAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMI Predict reactive species |
| Full Name | CD9 molecule |
| Calculated Molecular Weight | 228 aa, 25 kDa |
| Observed Molecular Weight | 23-27 kDa |
| GenBank Accession Number | BC011988 |
| Gene Symbol | CD9 |
| Gene ID (NCBI) | 928 |
| RRID | AB_11232215 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P21926 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405). CD9 is also known as the p24 antigen besides MIC3, TSPAN29 because it is a protein of molecular weight 24 kD. The CD9 antigen appears to be a 227-amino acid molecule with 4 hydrophobic domains and 1 N-glycosylation site.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD9 antibody 60232-1-Ig | Download protocol |
| IHC protocol for CD9 antibody 60232-1-Ig | Download protocol |
| WB protocol for CD9 antibody 60232-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CD9 Monoclonal antibody (4H7B9), catalog number 60232-1-Ig, has 179 citations across journals including Nature Cancer, Nature Communications, ACS Nano, Cell Death & Disease, Advanced Science, Theranostics, Journal of Extracellular Vesicles, EMBO Molecular Medicine, Brain, and eLife. Associated research fields include exosome/extracellular vesicle biology, oncology, neurodegeneration, cardiovascular disease, immune and inflammatory disorders, stem cell therapy, tissue regeneration, infectious disease, and metabolic disorders.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther The interferon-stimulated exosomal hACE2 potently inhibits SARS-CoV-2 replication through competitively blocking the virus entry. | ||
Nat Cancer Concurrent inhibition of tumor growth and metastasis by a lipidated nanophotosensitizer tracing and disabling tumor extracellular vesicles | ||
Nat Biomed Eng Rapid and sensitive detection of cancer-derived small extracellular vesicles using Janus particles. | ||
Cancer Res Proteomic Profiling of Serum Extracellular Vesicles Identifies Diagnostic Signatures and Therapeutic Targets in Breast Cancer | ||
J Extracell Vesicles The 8-oxoguanine DNA glycosylase-synaptotagmin 7 pathway increases extracellular vesicle release and promotes tumour metastasis during oxidative stress | ||
J Extracell Vesicles 124I-labelled BMSC-Derived Extracellular Vesicles Deliver CRISPR/Cas9 Ribonucleoproteins With a GFP-Reporter System to Inhibit Osteosarcoma Proliferation and Metastasis |
Reviews
What customers say
One customer review was submitted in March 2022 by Guorong Sun for Western Blot on ARPE-19 cells using lot 10004112 at a 1:5000 dilution. The reviewer rated the product 2 out of 5 and reported very weak bands with strong background at the expected 25 kDa molecular weight. Overall, the feedback indicates suboptimal signal-to-noise performance under these conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Guorong (Verified Customer) (03-22-2022) | Very weak bands with strong background were detected at 25 kDa
 |
