• Featured Product
  • KD/KO Validated

Biotin-conjugated CD9 Monoclonal antibody

CD9 Monoclonal Antibody for IHC
Cat No. Biotin-60232
Clone No.4H7B9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC

5H9, 5H9 antigen, BA2, BTCC 1, CD9, CD9 antigen, CD9 molecule, DRAP 27, GIG2, Leukocyte antigen MIC3, MIC3, Motility related protein, MRP 1, P24, Tetraspanin 29, Tspan 29, TSPAN29

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman ovary tumor tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-60232 targets CD9 in IHC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14529

Product name: Recombinant human CD9 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 100-208 aa of BC011988

Sequence: FAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMI

Predict reactive species
Full Name CD9 molecule
Calculated Molecular Weight 228 aa, 25 kDa
Observed Molecular Weight 23-27 kDa
GenBank Accession NumberBC011988
Gene Symbol CD9
Gene ID (NCBI) 928
RRIDAB_3083811
Conjugate Biotin
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP21926
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405). CD9 is also known as the p24 antigen besides MIC3, TSPAN29 because it is a protein of molecular weight 24 kD. The CD9 antigen appears to be a 227-amino acid molecule with 4 hydrophobic domains and 1 N-glycosylation site.

Protocols

Product Specific Protocols
IHC protocol for Biotin CD9 antibody Biotin-60232Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...