• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated CD9 Monoclonal antibody

CD9 Monoclonal Antibody for IF-P
Cat No. CL488-60232
Clone No.4H7B9

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

IF-P

5H9, 5H9 antigen, BA2, BTCC 1, CD9, CD9 antigen, CD9 molecule, Cell and organelle markers, DRAP 27, Exosome marker, GIG2, Leukocyte antigen MIC3, MIC3, Motility related protein, MRP 1, P24, Tetraspanin 29, Tspan 29, TSPAN29

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman lung cancer tissue, human breast cancer tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

CL488-60232 targets CD9 in IF-P applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14529

Product name: Recombinant human CD9 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 100-208 aa of BC011988

Sequence: FAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMI

Predict reactive species
Full Name CD9 molecule
Calculated Molecular Weight 228 aa, 25 kDa
Observed Molecular Weight 23-27 kDa
GenBank Accession NumberBC011988
Gene Symbol CD9
Gene ID (NCBI) 928
RRIDAB_2919239
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP21926
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405). CD9 is also known as the p24 antigen besides MIC3, TSPAN29 because it is a protein of molecular weight 24 kD. The CD9 antigen appears to be a 227-amino acid molecule with 4 hydrophobic domains and 1 N-glycosylation site.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CD9 antibody CL488-60232Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Front Microbiol

Enterovirus 71 non-structural protein 3A hijacks vacuolar protein sorting 25 to boost exosome biogenesis to facilitate viral replication

Authors - Zhihui Ruan
Loading...
||
New chat

Able

正在加载,请稍候...