Product Information
98162-1-PBS targets CD90 in FC applications and shows reactivity with rat samples.
| Tested Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1463 Product name: Recombinant Rat CD90/Thy1 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-130 aa of NM_012673.2 Sequence: QRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVKC Predict reactive species |
| Full Name | Thy-1 cell surface antigen |
| Calculated Molecular Weight | 18 kDa |
| GenBank Accession Number | NM_012673.2 |
| Gene Symbol | Thy1 |
| Gene ID (NCBI) | 24832 |
| RRID | AB_3672305 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P01830 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CD90 (Thy-1) is a 25 kDa, GPI-linked membrane glycoprotein that belongs to immunoglobulin superfamily (PMID: 6177036; 6153212). Originally described as a brain thymus cross-reactive antigen, it is found in large quantities on mouse and rat thymocytes and central nervous system cells (PMID: 83175). CD90 has been postulated to be involved in cellular recognition, adherence, and T cell activation (PMID: 7683034).



