Anti-Rat CD90 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of rat thymocytes using 98162-1-RR (same clone as 98162-1-PBS)

  1x10^6 rat thymocytes were surface stained with 0.25 ug Anti-Rat CD90 Rabbit Recombinant Antibody (98162-1-RR, Clone:241388F3) (red) or 0.25 ug Isotype Control (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98162-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98162-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98182-1-RR against Rat CD90 were performed. The affinity constant is 62.5 pM.

CD90 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98162-1-PBS

Clone No.241388F3

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

FC

Synonyms

241388F3, Thy1, Thy-1, Thy-1 antigen, Thy-1 membrane glycoprotein

---

Product Information

98162-1-PBS targets CD90 in FC applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1463

  Product name: Recombinant Rat CD90/Thy1 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 20-130 aa of NM_012673.2

  Sequence: QRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVKC

• Full Name: Thy-1 cell surface antigen
• Calculated Molecular Weight: 18 kDa
• GenBank Accession Number: NM_012673.2
• Gene Symbol: Thy1
• Gene ID (NCBI): 24832
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P01830
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD90 (Thy-1) is a 25 kDa, GPI-linked membrane glycoprotein that belongs to immunoglobulin superfamily (PMID: 6177036; 6153212). Originally described as a brain thymus cross-reactive antigen, it is found in large quantities on mouse and rat thymocytes and central nervous system cells (PMID: 83175). CD90 has been postulated to be involved in cellular recognition, adherence, and T cell activation (PMID: 7683034).