CDC14A Polyclonal antibody

• 

  WB analysis of human heart using 13660-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 13660-1-AP (CDC14A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 13660-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 13660-1-AP (CDC14A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 13660-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13660-1-AP (CDC14A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 13660-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 13660-1-AP (CDC14A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

CDC14A Polyclonal Antibody for WB, ELISA

Cat No. 13660-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

cdc14, CDC14A, hCDC14

---

Tested Applications

• Positive WB detected in: human heart tissue, human brain tissue, HeLa cells, COLO 320 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

13660-1-AP targets CDC14A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4556

  Product name: Recombinant human CDC14A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-191 aa of BC038979

  Sequence: MAAESGELIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYADFGPLNLAMVYRYCCKLNKKLKSYSLSRKKIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLSGSNPPYLPFRDASFGNCTYNLTILDCLQGIRKGLQHGFFDFETFDVDEYEHYEVILFTPLKPTFLISKSIM

• Full Name: CDC14 cell division cycle 14 homolog A (S. cerevisiae)
• Calculated Molecular Weight: 594 aa, 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC038979
• Gene Symbol: CDC14A
• Gene ID (NCBI): 8556
• RRID: AB_2260218
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UNH5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Med Rep; Phospho‑regulation of Cdc14A by polo‑like kinase 1 is involved in β‑cell function and cell cycle regulation.; Authors - Haiying Hu