CDC20 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84531-5-RR (same clone as 84531-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84531-5-RR (CDC20 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84531-5-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 84531-5-RR (same clone as 84531-5-PBS)

  WB result of CDC20 antibody (84531-5-RR; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CDC20 transfected HeLa cells. This data was developed using the same antibody clone with 84531-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 84531-5-RR (same clone as 84531-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 84531-5-RR (CDC20 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84531-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 84531-5-RR (same clone as 84531-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 84531-5-RR (CDC20 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84531-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84531-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84531-5-RR against Human CDC20 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

CDC20 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84531-5-PBS

Clone No.241925E12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

241925E12, CDC20A, p55CDC

---

Product Information

84531-5-PBS targets CDC20 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0295

  Product name: Recombinant human CDC20 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-211 aa of BC001088

  Sequence: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSA

• Full Name: cell division cycle 20 homolog (S. cerevisiae)
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC001088
• Gene Symbol: CDC20
• Gene ID (NCBI): 991
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q12834
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cdc20 (Cell-division cycle protein 20 homologue) is also named as p55CDC and belongs to the WD repeat CDC20/Fizzy family. Cdc20 has important functions in chromosome segregation and mitotic exit. Cdc20 is the target of the spindle assembly checkpoint (SAC) and a key cofactor of the anaphase-promoting complex or cyclosome (APC/CCDC20) E3 ubiquitin ligase, thus regulating APC/C ubiquitin activity on specific substrates for their subsequent degradation by the proteasome (PMID: 28202332). The 55-kDa band corresponded to the size of Cdc20 (PMID: 22566641).