CDC40 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84679-4-RR (same clone as 84679-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84679-4-RR (CDC40 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84679-4-PBS in a different storage buffer formulation.

• 

  IF Staining of K-562 using 84679-4-RR (same clone as 84679-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using CDC40 antibody (84679-4-RR, Clone: 242034D1 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84679-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84679-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84679-4-RR against Human CDC40 were performed. The affinity constant is below 1 pM.

CDC40 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 84679-4-PBS

Clone No.242034D1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

242034D1, Cell division cycle 40 homolog, EH binding protein 3, EHB3, hPRP17

---

Product Information

84679-4-PBS targets CDC40 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag36151

  Product name: Recombinant human CDC40 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-243 aa of BC126114

  Sequence: LAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHV

• Full Name: cell division cycle 40 homolog (S. cerevisiae)
• Observed Molecular Weight: 65-67 kDa
• GenBank Accession Number: BC126114
• Gene Symbol: CDC40
• Gene ID (NCBI): 51362
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O60508
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CDC40 (cell division cycle 40), also known as EHB3. It is expected to be located in the nucleus, which is ubiquitinated in bone marrow and lymph node. The protein is required for pre-mRNA splicing as component of the activated spliceosome, and it plays an important role in embryonic brain development; this function does not require proline isomerization (PMID: 33220177; 33220177). The molecular weight of CDC40 is 65 kDa.