CDC42SE1 Polyclonal antibody

• 

  IHC staining of human tonsillitis using 12427-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 12427-1-AP (CDC42SE1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 12427-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 12427-1-AP (CDC42SE1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CDC42SE1 Polyclonal Antibody for IHC, ELISA

Cat No. 12427-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

SPEC1, SCIP1, CDC42-binding protein SCIP1, CDC42 small effector protein 1, CDC42 small effector 1

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12427-1-AP targets CDC42SE1 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3098

  Product name: Recombinant human CDC42SE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-79 aa of BC012796

  Sequence: MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL

• Full Name: CDC42 small effector 1
• Calculated Molecular Weight: 79 aa, 9 kDa
• GenBank Accession Number: BC012796
• Gene Symbol: CDC42SE1
• Gene ID (NCBI): 56882
• RRID: AB_3669138
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRR8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDC42SE1, also known as SPEC1, is a small effector protein of 9 kDa. CDC42SE1 consists of 79 amino acids, including a conserved CRIB domain, 2 conserved cysteines at the N-terminus, and a basic amino acid before the CRIB domain. CDC42SE1 has been shown to inhibit CDC42-induced JNK activity and cell morphological changes in COS1 cells (PMID: 23957315).