CDC42SE2 Polyclonal antibody

• 

  IHC staining of human colon using 21424-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 21424-1-AP (CDC42SE2 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human colon using 21424-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 21424-1-AP (CDC42SE2 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human lymphoma using 21424-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 21424-1-AP (CDC42SE2 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human lymphoma using 21424-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 21424-1-AP (CDC42SE2 Antibody) at dilution of 1:50 (under 40x lens).

CDC42SE2 Polyclonal Antibody for IHC, ELISA

Cat No. 21424-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

CDC42 small effector 2, CDC42 small effector protein 2, CDC42SE2, SPEC2

---

Tested Applications

• Positive IHC detected in: human colon tissue, human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21424-1-AP targets CDC42SE2 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16011

  Product name: Recombinant human CDC42SE2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-84 aa of BC096703

  Sequence: MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG

• Full Name: CDC42 small effector 2
• Calculated Molecular Weight: 84 aa, 9 kDa
• GenBank Accession Number: BC096703
• Gene Symbol: CDC42SE2
• Gene ID (NCBI): 56990
• RRID: AB_2878856
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRR3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.