CDH23 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CDH23 Polyclonal antibody (13496-1-AP)

CDH23 Polyclonal Antibody for WB, ELISA

Cat No. 13496-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

CAD23, Cadherin 23, cadherin like 23, CDH23, DFNB12, KIAA1774, KIAA1812, Otocadherin, USH1D

• 

  WB analysis of A431 using 13496-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 13496-1-AP (CDH23 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Y79 using 13496-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 13496-1-AP (CDH23 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CDH23 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, Y79 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13496-1-AP targets CDH23 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4322

  Product name: Recombinant human CDH23 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-352 aa of BC032581

  Sequence: MGRHVATSCHVAWLLVLISGCWGQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSQFFAIDSARGIVTVIRELDYETTQAYQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLPYSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSE

• Full Name: cadherin-like 23
• Calculated Molecular Weight: 3354 aa, 369 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC032581
• Gene Symbol: CDH23
• Gene ID (NCBI): 64072
• RRID: AB_10667006
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H251
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CDH23 Polyclonal antibody (Cat# 13496-1-AP) has 1 total citation. It was cited in Human Molecular Genetics in a study examining the impact of Usher syndrome on olfaction, using WB and IF applications in mouse samples. The associated research field is genetic disease and sensory biology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Hum Mol Genet; Impact of the Usher syndrome on olfaction.; Authors - Fabian Jansen