CDH9 Polyclonal antibody

• 

  WB analysis using 21737-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21737-1-AP (CDH9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

CDH9 Polyclonal Antibody for WB, ELISA

Cat No. 21737-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Cadherin 9, Cadherin-9

---

Tested Applications

• Positive WB detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21737-1-AP targets CDH9 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16437

  Product name: Recombinant human CDH9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 469-541 aa of BC113745

  Sequence: SSHIPVFIRILDINDHAPEFAMYYETFVCENAKPGQLIQTVSVMDKDDPPRGHKFFFEPVPEFTLNPNFTIVD

• Full Name: cadherin 9, type 2 (T1-cadherin)
• Calculated Molecular Weight: 789 aa, 89 kDa
• Observed Molecular Weight: 107 kDa
• GenBank Accession Number: BC113745
• Gene Symbol: CDH9
• Gene ID (NCBI): 1007
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULB4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDH9, also known as Cadherin 9, is a type of cadherin that plays a significant role in cell adhesion and tissue organization. It is a member of the cadherin superfamily, which is a group of transmembrane glycoproteins that mediate cell-cell adhesion. (PMID: 36315446)