CDIPT Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CDIPT Polyclonal antibody, PBS Only (22465-1-PBS)

• 

  IHC staining of mouse brain using 22465-1-AP (same clone as 22465-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22465-1-AP (CDIPT antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22465-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 22465-1-AP (same clone as 22465-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22465-1-AP (CDIPT antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22465-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 22465-1-AP (same clone as 22465-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 22465-1-AP (CDIPT antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22465-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 22465-1-AP (same clone as 22465-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 22465-1-AP (CDIPT antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22465-1-PBS in a different storage buffer formulation.

CDIPT Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 22465-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

22465-1-PBS targets CDIPT in IHC, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18026

  Product name: Recombinant human CDIPT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 86-150 aa of BC001444

  Sequence: LYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNEL

• Full Name: CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase)
• Calculated Molecular Weight: 213 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC001444
• Gene Symbol: CDIPT
• Gene ID (NCBI): 10423
• RRID: AB_3085698
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: O14735
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.