CDK13 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CDK13 Polyclonal antibody, PBS Only (30461-1-PBS)

• 

  WB analysis using 30461-1-AP (same clone as 30461-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30461-1-AP (CDK13 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30461-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 30461-1-AP (same clone as 30461-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 30461-1-AP (CDK13 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30461-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 30461-1-AP (same clone as 30461-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CDK13 antibody (30461-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 30461-1-PBS in a different storage buffer formulation.

• 

  FC experiment of K-562 using 30461-1-AP (same clone as 30461-1-PBS)

  1X10^6 K-562 cells were intracellularly stained with 0.4 ug Anti-Human CDK13 (30461-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 30461-1-PBS in a different storage buffer formulation.

CDK13 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 30461-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

CDC2L5, CHED, CDC2L, CDC2 related protein kinase 5

---

Product Information

30461-1-PBS targets CDK13 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32897

  Product name: Recombinant human CDK13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1150-1300 aa of NM_003718.4

  Sequence: QESSKPLGGIQPSSQTIQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKDVLLEERENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMRILELTPEPDRPRILPPDQRPPEPPEPPPVTEEDLDYRTENQHVPTTSSSLTDPHAGVKA

• Full Name: cell division cycle 2-like 5 (cholinesterase-related cell division controller)
• Calculated Molecular Weight: 165 kDa
• Observed Molecular Weight: 170 kDa
• GenBank Accession Number: NM_003718.4
• Gene Symbol: CDK13
• Gene ID (NCBI): 8621
• RRID: AB_3086325
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14004
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cyclin-dependent kinase 13 (CDK13) is also named as CDC2L, CDC2L5, CHED and KIAA1791, and belongs to the CMGC Ser/Thr protein kinase family. Interestingly, in TNBC cells silencing CDK13 provokes cell death without affecting DDR genes. Like CDK12, CDK13 phosphorylates the Ser2 position of the heptad repeat in the CTD of RNA Pol II (PMID:26748711). CDK13/CycK complex is that regulates transcription by phosphorylating serine residues at positions 5 and 2 of the heptapeptide repeats (Y-S-P-T-S-P-S) comprising the C-terminal domain (CTD) of RPB1, the largest subunit of RNA polymerase II (RNAPII). CDK13 is expressed in fetal brain, liver, and muscle, and adult whole brain, hippocampus, and bone marrow (PMID:30904094).