CDK2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83635-4-RR (same clone as 83635-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83635-4-RR (CDK2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83635-4-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83635-4-RR (same clone as 83635-4-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug CDK2 Recombinant antibody (83635-4-RR, Clone:240580A11) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set. This data was developed using the same antibody clone with 83635-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83635-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83635-4-RR against Human CDK2 were performed. The affinity constant is 8.32 nM.

CDK2 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83635-4-PBS

Clone No.240580A11

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, FC (Intra), ELISA

Synonyms

EC:2.7.11.22, Cyclin-dependent kinase 2, Cyclin dependent kinase 2, Cell division protein kinase 2, CDKN2

---

Product Information

83635-4-PBS targets CDK2 in WB, FC (Intra), ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17133

  Product name: Recombinant human CDK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 217-298 aa of BC003065

  Sequence: RTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL

• Full Name: cyclin-dependent kinase 2
• Calculated Molecular Weight: 298 aa, 34 kDa
• Observed Molecular Weight: 30-33 kDa
• GenBank Accession Number: BC003065
• Gene Symbol: CDK2
• Gene ID (NCBI): 1017
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P24941
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CDK2(Cyclin-dependent kinase 2) is also named as CDKN2 and belongs to the protein kinase superfamily,CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily.It is involved in the control of the cell cycle; essential for meiosis, but dispensable for mitosis.It has 2 isoforms produced by alternative splicing.