CDK2AP2 Polyclonal antibody

CDK2AP2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15423-1-AP

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CDK2 associated protein 2, CDK2-associated protein 2, Cyclin-dependent kinase 2-associated protein 2, DOC 1 related protein, DOC 1R

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of HeLa using 15423-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 15423-1-AP (CDK2AP2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse intestine using 15423-1-AP
Immunohistochemical analysis of paraffin-embedded mouse intestine tissue slide using 15423-1-AP (CDK2AP2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary tumor using 15423-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 15423-1-AP (CDK2AP2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 15423-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15423-1-AP (CDK2AP2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 15423-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15423-1-AP (CDK2AP2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse adrenal gland using 15423-1-AP
Immunohistochemical analysis of paraffin-embedded mouse adrenal gland tissue slide using 15423-1-AP (CDK2AP2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse heart using 15423-1-AP
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15423-1-AP (CDK2AP2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat adrenal gland using 15423-1-AP
Immunohistochemical analysis of paraffin-embedded rat adrenal gland tissue slide using 15423-1-AP (CDK2AP2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat small intestine using 15423-1-AP
Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 15423-1-AP (CDK2AP2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells
Positive IHC detected in	mouse intestine, human ovary tumor tissue, human stomach cancer tissue, mouse adrenal gland tissue, mouse heart tissue, rat adrenal gland tissue, rat small intestine tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:200-1:1000
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15423-1-AP targets CDK2AP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag7730 Product name: Recombinant human CDK2AP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-126 aa of BC002850 Sequence: MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART Predict reactive species
Full Name	cyclin-dependent kinase 2 associated protein 2
Calculated Molecular Weight	13 kDa
Observed Molecular Weight	16 kDa
GenBank Accession Number	BC002850
Gene Symbol	CDK2AP2
Gene ID (NCBI)	10263
RRID	AB_2878135
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O75956
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.