CDK5 Monoclonal antibody, PBS Only

• 

  WB analysis using 68514-1-Ig (same clone as 68514-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68514-1-Ig (CDK5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68514-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 68514-1-Ig (same clone as 68514-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68514-1-Ig (CDK5 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68514-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 68514-1-Ig (same clone as 68514-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68514-1-Ig (CDK5 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68514-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 68514-1-Ig (same clone as 68514-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using CDK5 antibody (68514-1-Ig, Clone: 1B9E1 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68514-1-PBS in a different storage buffer formulation.

CDK5 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 68514-1-PBS

Clone No.1B9E1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1B9E1, Cdk 5, Cyclin-dependent kinase 5, Cyclin-dependent-like kinase 5, EC:2.7.11.1

---

Product Information

68514-1-PBS targets CDK5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28465

  Product name: Recombinant human CDK5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 92-273 aa of BC005115

  Sequence: DSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQ

• Full Name: cyclin-dependent kinase 5
• Calculated Molecular Weight: 31 kDa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC005115
• Gene Symbol: CDK5
• Gene ID (NCBI): 1020
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q00535
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cyclin-dependent kinase 5 (CDK5), belongs to the cyclin-dependent kinase family, is a proline-directed serine/threonine-protein kinase that essential for neuronal cell cycle arrest and differentiation and may be involved in apoptotic cell death in neuronal diseases by triggering abortive cell cycle re-entry. CDK5 predominantly expressed in neurons where it phosphorylates both high molecular weight neurofilaments and microtubule-associated protein tau.