CDK5RAP2 Polyclonal antibody

• 

  WB analysis using 31702-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31702-1-AP (CDK5RAP2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

CDK5RAP2 Polyclonal Antibody for WB, ELISA

Cat No. 31702-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

MCPH3, CEP215, Centrosome-associated protein 215, CDK5 regulatory subunit-associated protein 2, CDK5 activator-binding protein C48

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

31702-1-AP targets CDK5RAP2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36245

  Product name: Recombinant human CDK5RAP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1221-1571 aa of BC146782

  Sequence: MQLFSEIHNLQNKFRDLSPPRYDSLVQSQARELSLQRQQIKDGHGICVISRQHMNTMIKAFEELLQASDVDYCVAEGFQEQLNQCAELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSVMVNSFSQDLLMEHIQEIRTLRKRLEESIKTNEKLRKQLERQGSEFVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQKENDKLRESLSRKTVSLEHLQREYASVKEENERLQKEGSEKERHNQQLIQEVRCSGQELSRVQEELKLRQQLLSQNDKLLQSLRVELKAYEKLDEEH

• Full Name: CDK5 regulatory subunit associated protein 2
• Calculated Molecular Weight: 1893 aa, 215 kDa
• Observed Molecular Weight: 210-215 kDa
• GenBank Accession Number: BC146782
• Gene Symbol: CDK5RAP2
• Gene ID (NCBI): 55755
• RRID: AB_3670087
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96SN8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclin-dependent kinase 5 regulatory subunit associated protein 2 (CDK5RAP2) is a pericentriolar matrix (PCM) protein that regulates centriole engagement and centrosome cohesion during the cell cycle. CDK5RAP2 is associated with several cancers, including breast cancer, oral squamous cell carcinoma and haematological malignancies.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Adv Sci (Weinh); m6A Reader hnRNPA2B1 Modulates Late Pachytene Progression in Male Meiosis Through Post-Transcriptional Control; Authors - Lisha Yin