CDK8 Recombinant monoclonal antibody

• 

  WB analysis using 83621-6-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83621-6-RR (CDK8 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 83621-6-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CDK8 antibody (83621-6-RR, Clone: 240598G9 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  FC experiment of Caco-2 using 83621-6-RR

  1x10^6 Caco-2 cells were intracellularly stained with 0.25 ug CDK8 Recombinant antibody (83621-6-RR, Clone:240598G9) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• 

  Affinity and Kinetic Characterization of 83621-6-RR

  Biolayer interferometry (BLl) kinetic assays of 83621-6-RR against Human CDK8 were performed. The affinity constant is 12.5 nM.

CDK8 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 83621-6-RR

Clone No.240598G9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

K35, EC:2.7.11.22, Cyclin-dependent kinase 8, Cyclin dependent kinase 8, Cell division protein kinase 8

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, NIH/3T3 cells, RAW 264.7 cells, A549 cells, HCT 116 cells
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: Caco-2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83621-6-RR targets CDK8 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17148

  Product name: Recombinant human CDK8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 360-464 aa of BC069634

  Sequence: TEEEPDDKGDKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY

• Full Name: cyclin-dependent kinase 8
• Calculated Molecular Weight: 464 aa, 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC069634
• Gene Symbol: CDK8
• Gene ID (NCBI): 1024
• RRID: AB_3671234
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P49336
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.