CDK9 Recombinant monoclonal antibody

CDK9 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 83662-2-RR
Clone No.240600E3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

CTK1, Cell division cycle 2-like protein kinase 4, CDC2L4, C-2K, C 2k

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HeLa cells, Jurkat cells, HT-29 cells, HEK-293 cells
Positive IHC detected inhuman lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83662-2-RR targets CDK9 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2318

Product name: Recombinant human CDK9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-372 aa of BC001968

Sequence: MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF

Predict reactive species
Full Name cyclin-dependent kinase 9
Calculated Molecular Weight 372 aa, 43 kDa
Observed Molecular Weight 38-42 kDa, 55 kDa
GenBank Accession NumberBC001968
Gene Symbol CDK9
Gene ID (NCBI) 1025
RRIDAB_3671268
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP50750
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDK9(Cyclin-dependent kinase 9) is a member of the Cdc2-like family of kinases. Its cyclin partners are members of the family of cyclin T (T1, T2a and T2b) and cyclin K. The CDK9/cyclin T complexes appear to be involved in regulating several physiological processes. CDK9 has also been described as the kinase of the TAK complex, which is homologous to the P-TEFb complex and involved in HIV replication. In addition, CDK9 seems to have an anti-apoptotic function in monocytes, that may be related to its control over differentiation of monocytes (PMID: 12432243). CDK9 has two isoforms with the molecular mass of 42 kDa and 55 kDa, and the relative abundance of Cdk9(42kDa) and Cdk9(55kDa) changes in different cell types (PMID: 12706900, 15780980).

Protocols

Product Specific Protocols
WB protocol for CDK9 antibody 83662-2-RRDownload protocol
IHC protocol for CDK9 antibody 83662-2-RRDownload protocol
IF protocol for CDK9 antibody 83662-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...