CDK9 Recombinant monoclonal antibody

• 

  IHC staining of human lung cancer using 83662-7-RR

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 83662-7-RR (CDK9 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 83662-7-RR

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 83662-7-RR (CDK9 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 83662-7-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CDK9 antibody (83662-7-RR, Clone: 240600D7 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of HeLa using 83662-7-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CDK9 antibody (83662-7-RR, Clone: 240600D7 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of HeLa using 83662-7-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CDK9 antibody (83662-7-RR, Clone: 240600D7 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 83662-7-RR

  Biolayer interferometry (BLl) kinetic assays of 83662-7-RR against Human CDK9 were performed. The affinity constant is below 1 pM.

CDK9 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, ELISA

Cat No. 83662-7-RR

Clone No.240600D7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

CTK1, Cell division cycle 2-like protein kinase 4, CDC2L4, C-2K, C 2k

---

Tested Applications

• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83662-7-RR targets CDK9 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2318

  Product name: Recombinant human CDK9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-372 aa of BC001968

  Sequence: MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF

• Full Name: cyclin-dependent kinase 9
• Calculated Molecular Weight: 372 aa, 43 kDa
• Observed Molecular Weight: 38-42 kDa, 55 kDa
• GenBank Accession Number: BC001968
• Gene Symbol: CDK9
• Gene ID (NCBI): 1025
• RRID: AB_3671269
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P50750
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDK9(Cyclin-dependent kinase 9) is a member of the Cdc2-like family of kinases. Its cyclin partners are members of the family of cyclin T (T1, T2a and T2b) and cyclin K. The CDK9/cyclin T complexes appear to be involved in regulating several physiological processes. CDK9 has also been described as the kinase of the TAK complex, which is homologous to the P-TEFb complex and involved in HIV replication. In addition, CDK9 seems to have an anti-apoptotic function in monocytes, that may be related to its control over differentiation of monocytes (PMID: 12432243).