Use Able AI chat for product recommendations

CDKAL1 Polyclonal antibody

CDKAL1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

CDK5 regulatory subunit-associated protein 1-like 1, EC:2.8.4.5, Threonylcarbamoyladenosine tRNA methylthiotransferase, tRNA-t(6)A37 methylthiotransferase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CDKAL1 in ?

Tested Applications

Positive WB detected inHepG2 cells, HT-1080 cells, mouse lung tissue, Jurkat cells, L02 cells, SH-SY5Y cells, rat lung tissue
Positive IHC detected inhuman oesophagus tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, HepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22988-1-AP targets CDKAL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19060

Product name: Recombinant human CDKAL1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-357 aa of BC121020

Sequence: MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKIVLAGCVPQAQPRQDYLKGLSIIGVQQIDRVVEVVEETIKGHSVRLLGQKKDNGRRLGGARLDLPKIRKNPLIEIISINTGCLNACTYCKTKHARGNLASYPIDELVDRAKQSFQEGVCEIWLTSEDTGAYGRDIGTNLPTLLWKLVEVIPEGAMLRLGMTNPPYILEHLEEMAKILNHPRVYAFLHIPVQSASDSVLMEMKREYCVADFKRVVDFLKEKVPGIT

Predict reactive species
Full Name CDK5 regulatory subunit associated protein 1-like 1
Calculated Molecular Weight 579 aa, 65 kDa
Observed Molecular Weight 60-65 kDa
GenBank Accession NumberBC121020
Gene Symbol CDKAL1
Gene ID (NCBI) 54901
RRIDAB_2879192
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ5VV42
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cell cycle progression is controlled, in part, by a family of cyclin dependent kinases (Cdks) that work to phosphorylate key substrates involved in each phase of cell cycle progression. Cdks are the catalytic subunits of serine/threonine protein kinases, a large family of proteins that act as regulators of the eukaryotic cell cycle. CDKAL1 (Cdk5 regulatory subunit associated protein 1-like 1) is a 579 amino acid single-pass membrane protein that contains one TRAM domain and is similar to Cdk5 regulatory subunit associated proteins (CDK5RAPs). Expressed in pancreas, brain and skeletal muscle, CDKAL1 uses iron as a cofactor and is involved in glucose-stimulated INS secretion. Defects in the gene encoding CDKAL1 impair INS secretion and are associated with the development of type 2 diabetes. Multiple isoforms of CDKAL1 exist due to alternative splicing events. This antibody recognizes the 65kd isoform of CDKAL1.

Protocols

Product Specific Protocols
IF protocol for CDKAL1 antibody 22988-1-APDownload protocol
IHC protocol for CDKAL1 antibody 22988-1-APDownload protocol
WB protocol for CDKAL1 antibody 22988-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The CDKAL1 Polyclonal antibody (Cat# 22988-1-AP) has 3 citations published in Journal of Clinical Investigation, Advanced Science, and EMBO Journal. The associated research fields include neuromuscular disorders involving nucleocytoplasmic Fe-S enzymes, cancer stem-like cell maintenance via eIF4F translation initiation complex assembly, and podocyte dysfunction in chronic kidney disease. Applications cited are WB (human) and IF (mouse).

SpeciesApplicationTitle
humanWB

J Clin Invest

CIAO1 loss of function causes a neuromuscular disorder with compromise of nucleocytoplasmic Fe-S enzymes

Authors - Nunziata Maio
humanWB

Adv Sci (Weinh)

CDKAL1 Drives the Maintenance of Cancer Stem-Like Cells by Assembling the eIF4F Translation Initiation Complex

Authors - Rongsheng Huang
mouseIF

EMBO J

CDKAL1 dysfunction impairs lysine codon translation in podocytes and accelerates chronic kidney disease.

Authors - Hiroko Nagata
  • KO Validated
Loading...
||
New chat

Able™

正在加载,请稍候...