CDKAL1 Polyclonal antibody

• 

  WB analysis of mouse lung using 22988-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 22988-1-AP (CDKAL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 22988-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 22988-1-AP (CDKAL1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HT-1080 using 22988-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 22988-1-AP (CDKAL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 22988-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 22988-1-AP (CDKAL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 22988-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 22988-1-AP (CDKAL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human oesophagus using 22988-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus slide using 22988-1-AP (CDKAL1 Antibody) at dilution of 1:50.

• 

  IHC staining of human oesophagus using 22988-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus slide using 22988-1-AP (CDKAL1 Antibody) at dilution of 1:50.

• 

  IF Staining of HepG2 using 22988-1-AP

  Immunofluorescent analysis of HepG2 cells using 22988-1-AP (CDKAL1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

CDKAL1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 22988-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CDKAL1

---

Tested Applications

• Positive WB detected in: mouse lung tissue, HepG2 cells, HT-1080 cells, Jurkat cells
• Positive IHC detected in: human oesophagus tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

22988-1-AP targets CDKAL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19060

  Product name: Recombinant human CDKAL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-357 aa of BC121020

  Sequence: MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKIVLAGCVPQAQPRQDYLKGLSIIGVQQIDRVVEVVEETIKGHSVRLLGQKKDNGRRLGGARLDLPKIRKNPLIEIISINTGCLNACTYCKTKHARGNLASYPIDELVDRAKQSFQEGVCEIWLTSEDTGAYGRDIGTNLPTLLWKLVEVIPEGAMLRLGMTNPPYILEHLEEMAKILNHPRVYAFLHIPVQSASDSVLMEMKREYCVADFKRVVDFLKEKVPGIT

• Full Name: CDK5 regulatory subunit associated protein 1-like 1
• Calculated Molecular Weight: 579 aa, 65 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC121020
• Gene Symbol: CDKAL1
• Gene ID (NCBI): 54901
• RRID: AB_2879192
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q5VV42
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cell cycle progression is controlled, in part, by a family of cyclin dependent kinases (Cdks) that work to phosphorylate key substrates involved in each phase of cell cycle progression. Cdks are the catalytic subunits of serine/threonine protein kinases, a large family of proteins that act as regulators of the eukaryotic cell cycle. CDKAL1 (Cdk5 regulatory subunit associated protein 1-like 1) is a 579 amino acid single-pass membrane protein that contains one TRAM domain and is similar to Cdk5 regulatory subunit associated proteins (CDK5RAPs). Expressed in pancreas, brain and skeletal muscle, CDKAL1 uses iron as a cofactor and is involved in glucose-stimulated INS secretion. Defects in the gene encoding CDKAL1 impair INS secretion and are associated with the development of type 2 diabetes. Multiple isoforms of CDKAL1 exist due to alternative splicing events. This antibody recognizes the 65kd isoform of CDKAL1.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Adv Sci (Weinh); CDKAL1 Drives the Maintenance of Cancer Stem-Like Cells by Assembling the eIF4F Translation Initiation Complex; Authors - Rongsheng Huang
human	WB	J Clin Invest; CIAO1 loss of function causes a neuromuscular disorder with compromise of nucleocytoplasmic Fe-S enzymes; Authors - Nunziata Maio