Use Able AI chat for product recommendations

CDKAL1 Polyclonal antibody

CDKAL1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

CDK5 regulatory subunit-associated protein 1-like 1, EC:2.8.4.5, Threonylcarbamoyladenosine tRNA methylthiotransferase, tRNA-t(6)A37 methylthiotransferase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CDKAL1 in ?

Tested Applications

Positive WB detected inHepG2 cells, HT-1080 cells, mouse lung tissue, Jurkat cells, L02 cells, SH-SY5Y cells, rat lung tissue
Positive IHC detected inhuman oesophagus tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, HepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22988-1-AP targets CDKAL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19060

Product name: Recombinant human CDKAL1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-357 aa of BC121020

Sequence: MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKIVLAGCVPQAQPRQDYLKGLSIIGVQQIDRVVEVVEETIKGHSVRLLGQKKDNGRRLGGARLDLPKIRKNPLIEIISINTGCLNACTYCKTKHARGNLASYPIDELVDRAKQSFQEGVCEIWLTSEDTGAYGRDIGTNLPTLLWKLVEVIPEGAMLRLGMTNPPYILEHLEEMAKILNHPRVYAFLHIPVQSASDSVLMEMKREYCVADFKRVVDFLKEKVPGIT

Predict reactive species
Full Name CDK5 regulatory subunit associated protein 1-like 1
Calculated Molecular Weight 579 aa, 65 kDa
Observed Molecular Weight 60-65 kDa
GenBank Accession NumberBC121020
Gene Symbol CDKAL1
Gene ID (NCBI) 54901
RRIDAB_2879192
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ5VV42
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cell cycle progression is controlled, in part, by a family of cyclin dependent kinases (Cdks) that work to phosphorylate key substrates involved in each phase of cell cycle progression. Cdks are the catalytic subunits of serine/threonine protein kinases, a large family of proteins that act as regulators of the eukaryotic cell cycle. CDKAL1 (Cdk5 regulatory subunit associated protein 1-like 1) is a 579 amino acid single-pass membrane protein that contains one TRAM domain and is similar to Cdk5 regulatory subunit associated proteins (CDK5RAPs). Expressed in pancreas, brain and skeletal muscle, CDKAL1 uses iron as a cofactor and is involved in glucose-stimulated INS secretion. Defects in the gene encoding CDKAL1 impair INS secretion and are associated with the development of type 2 diabetes. Multiple isoforms of CDKAL1 exist due to alternative splicing events. This antibody recognizes the 65kd isoform of CDKAL1.

Protocols

Product Specific Protocols
IF protocol for CDKAL1 antibody 22988-1-APDownload protocol
IHC protocol for CDKAL1 antibody 22988-1-APDownload protocol
WB protocol for CDKAL1 antibody 22988-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The CDKAL1 Polyclonal antibody (Cat# 22988-1-AP) has 3 citations. They appear in J Clin Invest (neuromuscular disorder and Fe-S enzyme biology), Advanced Science (cancer stem-like cell maintenance and translation initiation), and EMBO Journal (podocyte dysfunction and chronic kidney disease). Research fields span neurology, oncology, and nephrology, with applications in WB and IF across human and mouse models.

SpeciesApplicationTitle
humanWB

J Clin Invest

CIAO1 loss of function causes a neuromuscular disorder with compromise of nucleocytoplasmic Fe-S enzymes

Authors - Nunziata Maio
humanWB

Adv Sci (Weinh)

CDKAL1 Drives the Maintenance of Cancer Stem-Like Cells by Assembling the eIF4F Translation Initiation Complex

Authors - Rongsheng Huang
mouseIF

EMBO J

CDKAL1 dysfunction impairs lysine codon translation in podocytes and accelerates chronic kidney disease.

Authors - Hiroko Nagata
  • KO Validated
Loading...
||
New chat

Able™

正在加载,请稍候...