Filter: AllWB

WB analysis using 25702-1-AP (same clone as 25702-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 25702-1-AP (CDKL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25702-1-PBS in a different storage buffer formulation.

CDKL1 Polyclonal antibody, PBS Only

Name: CDKL1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 25702-1-PBS

CDKL1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25702-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

25702-1-PBS targets CDKL1 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag22541 Product name: Recombinant human CDKL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 255-358 aa of BC104977 Sequence: PNISYPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI Predict reactive species
Full Name	cyclin-dependent kinase-like 1 (CDC2-related kinase)
Calculated Molecular Weight	358 aa, 42 kDa
Observed Molecular Weight	32 kDa
GenBank Accession Number	BC104977
Gene Symbol	CDKL1
Gene ID (NCBI)	8814
RRID	AB_3669494
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q00532
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™