NKIAMRE Polyclonal antibody

• 

  WB analysis of HeLa using 13888-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13888-1-AP (NKIAMRE antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 13888-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13888-1-AP (NKIAMRE antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human gliomas using 13888-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 13888-1-AP (NKIAMRE antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 13888-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 13888-1-AP (NKIAMRE antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

NKIAMRE Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13888-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

CDKL3, cyclin dependent kinase like 3, NKIAMRE

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IHC: See 2 publications below

Product Information

13888-1-AP targets NKIAMRE in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4812

  Product name: Recombinant human CDKL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-279 aa of BC041799

  Sequence: MEMYETLGKVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSVNKIAMREIKFLKQFHHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIDYLHSNNIIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDIYTDYVATRWYRAPELVLKDTSYGKPVDIWALGCMIIEMATGNPYLPSSSDLDLLHKIVLKVGNLSPHLQNIFSKSPIFAGVVLPQVQHPKNARKKYPKLNGLLADIVHACLQIDPADRISSSD

• Full Name: cyclin-dependent kinase-like 3
• Calculated Molecular Weight: 592 aa, 68 kDa
• Observed Molecular Weight: 52-60 kDa
• GenBank Accession Number: BC041799
• Gene Symbol: NKIAMRE
• Gene ID (NCBI): 51265
• RRID: AB_2077463
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IVW4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NKIAMRE is also named as CDKL3(Cyclin-dependent kinase-like 3) and belongs to the protein kinase superfamily.This protein contains the MAPK-like TDY motif for threonine and tyrosine phosphorylation, as well as the putative cyclin-binding motif(PMID:10463609). It has 2 isoforms produced by alternative splicing with the molecular mass of 52 kDa and 68 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Front Oncol; CDKL3 Targets ATG5 to Promote Carcinogenesis of Esophageal Squamous Cell Carcinoma.; Authors - Suna Zhou
human	WB,IHC	Front Physiol; Curcumol Exerts Anticancer Effect in Cholangiocarcinoma Cells via Down-Regulating CDKL3.; Authors - Jinduo Zhang ; KD Validated