p18 INK4c Polyclonal antibody

• 

p18 INK4c Polyclonal Antibody for ELISA

Cat No. 12993-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

CDKN2C, CDKN6, INK4C, p18, p18 INK4C, p18 INK6

---

Product Information

12993-1-AP targets p18 INK4c in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3655

  Product name: Recombinant human CDKN2C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-168 aa of BC016173

  Sequence: MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHMASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ

• Full Name: cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)
• Calculated Molecular Weight: 168 aa, 18 kDa
• GenBank Accession Number: BC016173
• Gene Symbol: p18 INK4c/CDKN2C
• Gene ID (NCBI): 1031
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P42773
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.