CDS1 Polyclonal antibody

• 

CDS1 Polyclonal Antibody for ELISA

Cat No. 17898-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

CDP DAG synthase 1, CDP DG synthase 1, CDP diacylglycerol synthase 1, CDP diglyceride synthase 1, CDS, CDS 1, CDS1

---

Product Information

17898-1-AP targets CDS1 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12261

  Product name: Recombinant human CDS1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 252-461 aa of BC074881

  Sequence: NDITAYLFGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPFLKAVLRQERVSLYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPSKVLQQLLVLQPEQQLNIYKTLKTHLIEKGILQPTLKV

• Full Name: CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1
• Calculated Molecular Weight: 461 aa, 53 kDa
• GenBank Accession Number: BC074881
• Gene Symbol: CDS1
• Gene ID (NCBI): 1040
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92903
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.