CDS2 Recombinant monoclonal antibody, PBS Only (Detector)

CDS2 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 85162-1-PBS
Clone No.242787A10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

CDP DAG synthase 2, CDP DG synthase 2, CDP diacylglycerol synthase 2, CDP diglyceride synthase 2, CDP-DAG synthase 2

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85162-1-PBS targets CDS2 as part of a matched antibody pair:

MP01883-1: 85162-3-PBS capture and 85162-1-PBS detection (validated in Cytometric bead array)

MP01883-2: 85162-2-PBS capture and 85162-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29228

Product name: Recombinant human CDS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-65 aa of BC025751

Sequence: MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSR

Predict reactive species
Full Name CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
Calculated Molecular Weight 445 aa, 51 kDa
GenBank Accession NumberBC025751
Gene Symbol CDS2
Gene ID (NCBI) 8760
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95674
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...