CDSN Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CDSN Polyclonal antibody (13184-1-AP)

• Featured Product
• KD/KO Validated

CDSN Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13184-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

corneodesmosin, D6S586E, HTSS, S protein

• 

  WB analysis using 13184-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13184-1-AP (CDSN antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 13184-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 13184-1-AP (CDSN antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 13184-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 13184-1-AP (CDSN antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CDSN in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, NIH/3T3 cells
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13184-1-AP targets CDSN in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3854

  Product name: Recombinant human CDSN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 180-503 aa of BC031993

  Sequence: NSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPGVVQGPPCSNGGLPGKPCPPITSVDKSYGGYEVVGGSSDSYLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNPIIPSQSAASSAIAFQPVGTGGVQLCGGGSTGSKGPCSPSSSRVPSSSSISGSSGLPYHPCGSASQSPCSPPGTGSFSSSSSSQSSGKIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSAGKIPCRSIRDILA

• Full Name: corneodesmosin
• Calculated Molecular Weight: 528 aa, 52 kDa
• Observed Molecular Weight: 55-65 kDa
• GenBank Accession Number: BC031993
• Gene Symbol: CDSN
• Gene ID (NCBI): 1041
• RRID: AB_11183052
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15517
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDSN, also named as S protein, is important for the epidermal barrier integrity. CDSN is a unique extracellular 52- to 56-kDa glycoprotein found in corneodesmosomes. Pathogenic mutations in CDSN have been linked in humans to genodermatoses affecting both the hair follicle and the epidermis. Inflammatory peeling skin syndrome is caused a novel mutation in CDSN.

Publications

What published studies show

The CDSN Polyclonal antibody (Cat# 13184-1-AP) has 11 citations published in journals including Nature Neuroscience, Advanced Science, Phytomedicine, Journal of Investigative Dermatology, International Immunopharmacology, Molecules, iScience, Experimental Dermatology, Clinical, Cosmetic and Investigational Dermatology, Archives of Dermatological Research, and Heliyon. Research fields span epidermal barrier biology, keratinocyte differentiation, atopic dermatitis, psoriasis, spinal cord injury, and ovarian cancer.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Nat Neurosci; Derivation and transcriptional reprogramming of border-forming wound repair astrocytes after spinal cord injury or stroke in mice; Authors - Timothy M O'Shea
mouse	WB	Adv Sci (Weinh); Population-Based Multi-Omics and Cohort Study Identifying Predictive Biomarkers and Therapeutic Targets for Psoriatic Disease.; Authors - Tianxing Wu ; KD Validated
mouse,human	WB,IF	Phytomedicine; Targeting mitochondrial dysfunction in atopic dermatitis with trilinolein: A triacylglycerol from the medicinal plant Cannabis fructus; Authors - Yi Wang
mouse	WB	J Invest Dermatol; Sphingosine 1-Phosphate Receptor 2 Is Central to Maintaining Epidermal Barrier Homeostasis.; Authors - Satomi Igawa
human	WB	Int Immunopharmacol; Umbilical cord mesenchymal stem cell-derived exosomes delivered via a thermosensitive hydrogel ameliorate atopic dermatitis by mitigating keratinocyte mitochondrial damage through activating the Wnt/β-catenin pathway.; Authors - Xueping Zhao
human	WB	Molecules; Dual Regulation of Corneodesmosome Formation by Shotokuseki Extract Enhances Skin Barrier Homeostasis.; Authors - Kei Tsukui