CDSN Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CDSN Recombinant monoclonal antibody, PBS Only (85384-2-PBS)

CDSN Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85384-2-PBS

Clone No.261055C11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

corneodesmosin, D6S586E, HTSS, S protein

• 

  WB analysis using 85384-2-RR (same clone as 85384-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85384-2-RR (CDSN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85384-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 85384-2-RR (same clone as 85384-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 85384-2-RR (CDSN antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85384-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 85384-2-RR (same clone as 85384-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 85384-2-RR (CDSN antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85384-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

85384-2-PBS targets CDSN in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg10164

  Product name: Recombinant Human CDSN protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 33-529 aa of NM_001264.5

  Sequence: KSIGTFSDPCKDPTRITSPNDPCLTGKGDSSGFSSYSGSSSSGSSISSARSSGGGSSGSSSGSSIAQGGSAGSFKPGTGYSQVSYSSGSGSSLQGASGSSQLGSSSSHSGNSGSHSGSSSSHSSSSSSFQFSSSSFQVGNGSALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPGVVQGPPCSNGGLPGKPCPPITSVDKSYGGYEVVGGSSDSYLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNPIIPSQSAASSAIAFQPVGTGGVQLCGGGSTGSKGPCSPSSSRVPSSSSISSSSGLPYHPCGSASQSPCSPPGTGSFSSSSSSQSSGKIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSAGKIPCRSIRDILAQVKPLGPQLADPEVFLPQGELLNSP

• Full Name: corneodesmosin
• Calculated Molecular Weight: 52 kDa
• Observed Molecular Weight: 55-65 kDa
• GenBank Accession Number: NM_001264.5
• Gene Symbol: CDSN
• Gene ID (NCBI): 1041
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15517
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CDSN, also named as S protein, is important for the epidermal barrier integrity. CDSN is a unique extracellular 52- to 56-kDa glycoprotein found in corneodesmosomes. Pathogenic mutations in CDSN have been linked in humans to genodermatoses affecting both the hair follicle and the epidermis. Inflammatory peeling skin syndrome is caused a novel mutation in CDSN.