CDX4 Polyclonal antibody

• 

  WB analysis of SKOV-3 using 22943-1-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 22943-1-AP (CDX4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Sp2/0 using 22943-1-AP

  Sp2/0 cells were subjected to SDS PAGE followed by western blot with 22943-1-AP (CDX4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 22943-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 22943-1-AP (CDX4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

CDX4 Polyclonal Antibody for WB, ELISA

Cat No. 22943-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

caudal type homeobox 4, Caudal type homeobox protein 4, CDX4, Homeobox protein CDX 4

---

Tested Applications

• Positive WB detected in: SKOV-3 cells, mouse thymus tissue, Sp2/0 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22943-1-AP targets CDX4 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19078

  Product name: Recombinant human CDX4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-167 aa of BC128233

  Sequence: MYGSCLLEKEAGMYPGTLMSPGGDGTAGTGGTGGGGSPMPASNFAAAPAFSHYMGYPHMPSMDPHWPSLGVWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVT

• Full Name: caudal type homeobox 4
• Calculated Molecular Weight: 284 aa, 30 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC128233
• Gene Symbol: CDX4
• Gene ID (NCBI): 1046
• RRID: AB_2879187
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14627
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.