CDY1B Polyclonal antibody

• 

  WB analysis using 33231-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33231-1-AP (CDY1B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

CDY1B Polyclonal Antibody for WB, ELISA

Cat No. 33231-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CDY1, CDY1A, EC:2.3.1.48, Testis-specific chromodomain protein Y 1

---

Tested Applications

• Positive WB detected in: human testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33231-1-AP targets CDY1B in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37962

  Product name: Recombinant human CDY1B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 65-300 aa of BC132929

  Sequence: LTWTTTSRIFSNNARRRTSRSTKANYSKNSPKTPVTDKHHRSKNRKLFAASKNVRRKAASILSDTKNMEIINSTIETLAPDSPFDHKTVSGFQKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSRPGAEQTGIQNKTQIHPLMSQMSGSVTASMATGSATRKGIVVLIDPLAANGTTDMHTSVPRVKGGQRNITDDSRDQPFIKKMHFTIRLTESASTYRDIVVKKEDGFTQIVLS

• Full Name: chromodomain protein, Y-linked, 1B
• Calculated Molecular Weight: 540 aa, 60 kDa/554 aa, 62 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC132929
• Gene Symbol: CDY1B
• Gene ID (NCBI): 253175
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y6F8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The CDY1B gene, also known as Chromodomain Y-Linked 1B, is a Protein Coding gene located on the Y chromosome. It is one of the two identical copies of the CDY1 gene within the AZFc region of the human Y chromosome. As a histone acetyltransferase, CDY1B exhibits a strong preference for histone 4, suggesting its involvement in both spermatogenic histone replacement and DNA transcription. It plays a significant role in the chromatin remodeling of round spermatid nuclei, contributing to the transition from histone-based chromatin to protamine-based chromatin during spermatogenesis. This transition is essential for the condensation of sperm DNA and the formation of mature sperm. Deletion of either CDY1 can lead to spermatogenic failure and male infertility.