CEACAM5 Fusion Protein

Source

e coli.-derived, PGEX-4T

Tag

GST

Format

Liquid

Cat no : Ag0672

Synonyms

CD66e; CEA; DKFZp781M2392



Product Information

Peptide Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDSASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQ
(1-300 aa encoded by BC034671)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8. ) added with 100mM GSH and 15%glycerol.