CEACAM6/CD66c Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84982-2-RR (same clone as 84982-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84982-2-RR (CEACAM6 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84982-2-PBS in a different storage buffer formulation.

CEACAM6/CD66c Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84982-2-PBS

Clone No.241997D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CEACAM6, 241997D5, Carcinoembryonic antigen-related cell adhesion molecule 6, CD66c, CEAL

---

Product Information

84982-2-PBS targets CEACAM6/CD66c in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2450

  Product name: recombinant human CEACAM6 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 35-320 aa of BC005008

  Sequence: KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG

• Full Name: carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen)
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 45-100 kDa
• GenBank Accession Number: BC005008
• Gene Symbol: CEACAM6
• Gene ID (NCBI): 4680
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P40199
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CEACAM6, also known as CD66c, is a glycosylphosphatidylinositol (GPI)-linked cell surface protein that belongs to the CEACAM family of the immunoglobulin superfamily (PMID: 23903773). It is normally expressed on the surface of myeloid and epithelial surfaces and upregulated preferentially at the apical/luminal membranes of many tumors (PMID: 27595061; 35082925). CEACAM6 plays an important role in cell adhesion, proliferation, tumorigenesis, metastasis, and immunity (PMID: 31797958).