CEACAM7 Polyclonal antibody

• 

  WB analysis of mouse colon using 24626-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 24626-1-AP (CEACAM7 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 24626-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 24626-1-AP (CEACAM7 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 24626-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 24626-1-AP (CEACAM7 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CEACAM7 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24626-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Carcinoembryonic antigen CGM2, CEA, CEACAM7, CGM2

---

Tested Applications

• Positive WB detected in: mouse colon tissue
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24626-1-AP targets CEACAM7 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18579

  Product name: Recombinant human CEACAM7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 113-213 aa of BC121132

  Sequence: VTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGP

• Full Name: carcinoembryonic antigen-related cell adhesion molecule 7
• Calculated Molecular Weight: 265 aa, 29 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC121132
• Gene Symbol: CEACAM7
• Gene ID (NCBI): 1087
• RRID: AB_3085742
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14002
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CEACAM7, also known as CGM2, belongs to the carcinoembryonic antigen (CEA) family. CEACAM7 contains three domains: an N-terminal IgV domain, a single IgC2 domain, and a cell-surface GPI anchor domain. CEACAM7 achieves cell adhesion through dimerization of the N-terminal IgV domain. CEACAM7 is expressed on highly differentiated epithelial cells of the colon and rectum and on the epithelial cells within the ducts of the pancreas (PMID: 26323304). CEACAM7 has 2 isoforms with the molecular mass of 19 and 29 kDa. The observed MW of CEACAM7 is 58 kDa, which is consistent with the description in the literature (PMID: 36828119).