CEACAM7 Polyclonal antibody

CEACAM7 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 24626-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Carcinoembryonic antigen CGM2, CEA, CEACAM7, CGM2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse colon tissue
Positive IHC detected inhuman colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24626-1-AP targets CEACAM7 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18579

Product name: Recombinant human CEACAM7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 113-213 aa of BC121132

Sequence: VTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGP

Predict reactive species
Full Name carcinoembryonic antigen-related cell adhesion molecule 7
Calculated Molecular Weight 265 aa, 29 kDa
Observed Molecular Weight58 kDa
GenBank Accession NumberBC121132
Gene Symbol CEACAM7
Gene ID (NCBI) 1087
RRIDAB_3085742
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14002
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CEACAM7, also known as CGM2, belongs to the carcinoembryonic antigen (CEA) family. CEACAM7 contains three domains: an N-terminal IgV domain, a single IgC2 domain, and a cell-surface GPI anchor domain. CEACAM7 achieves cell adhesion through dimerization of the N-terminal IgV domain. CEACAM7 is expressed on highly differentiated epithelial cells of the colon and rectum and on the epithelial cells within the ducts of the pancreas (PMID: 26323304). CEACAM7 has 2 isoforms with the molecular mass of 19 and 29 kDa. The observed MW of CEACAM7 is 58 kDa, which is consistent with the description in the literature (PMID: 36828119).

Protocols

Product Specific Protocols
IHC protocol for CEACAM7 antibody 24626-1-APDownload protocol
WB protocol for CEACAM7 antibody 24626-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...