CEACAM8 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83105-3-PBS

  Biolayer interferometry (BLl) kinetic assays of 83105-3-PBS against Human CEACAM8 were performed. The affinity constant is 1.32 nM.

CEACAM8 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 83105-3-PBS

Clone No.230353B11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

CD66b, Carcinoembryonic antigen CGM6, Carcinoembryonic antigen-related cell adhesion molecule 8, CD 66b, CD 67

---

Product Information

83105-3-PBS targets CEACAM8 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg32133

  Product name: Recombinant Human CEACAM-8 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 35-319 aa of BC026263

  Sequence: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS

• Full Name: CEACAM8
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P31997
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.