CEACAM8/CD66b Recombinant monoclonal antibody

• 

  WB analysis using 83105-6-RR

  human peripheral blood leukocyte were subjected to SDS PAGE followed by western blot with 83105-6-RR (CEACAM8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 83105-6-RR

  human saliva were subjected to SDS PAGE followed by western blot with 83105-6-RR (CEACAM8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 83105-6-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 83105-6-RR (CEACAM8/CD66b antibody) at dilution of 1:10000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 83105-6-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 83105-6-RR (CEACAM8/CD66b antibody) at dilution of 1:10000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of Transfected CHO-K1 using 83105-6-RR

  Immunofluorescent analysis of (4% PFA) fixed Transfected CHO-K1 cells using CEACAM8 antibody (83105-6-RR, Clone: 242954B2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 83105-6-RR

  Biolayer interferometry (BLl) kinetic assays of 83105-6-RR against Human CEACAM8 were performed. The affinity constant is 14.1 nM.

CEACAM8/CD66b Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 83105-6-RR

Clone No.242954B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CD66b, CEACAM8, Carcinoembryonic antigen CGM6, Carcinoembryonic antigen-related cell adhesion molecule 8, CD 66b

---

Tested Applications

• Positive WB detected in: human saliva, human peripheral blood leukocyte
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Transfected CHO-K1

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:5000-1:20000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83105-6-RR targets CEACAM8/CD66b in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg32133

  Product name: Recombinant Human CEACAM-8 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 35-319 aa of BC026263

  Sequence: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS

• Full Name: carcinoembryonic antigen-related cell adhesion molecule 8
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 95-100kDa
• GenBank Accession Number: BC026263
• Gene Symbol: CEACAM8
• Gene ID (NCBI): 1088
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P31997
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8), also known as CD66b, CGM6 or NCA-95, is a member of the cacinoembryonic antigen (CEA) family which belongs to the immunoglobulin superfamily of cell adhesion molecules (PMID: 16919437). CEACAM8 is a glycosylphosphatidylinositol (GPI)-linked glycoprotein expressed on granulocytes (PMID: 8104998; 18056392). It is involved in regulating adhesion and activation of eosinophils (PMID: 18056392).