CEBP Alpha/CEBPA Polyclonal antibody

CEBP Alpha/CEBPA Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 29388-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

CEBP alpha, CEBPA, C/EBP alpha, C/EBPα, CCAAT/enhancer-binding protein alpha

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inBGC-823 cells, LNCaP cells, THP-1 cells, U-937 cells, K-562 cells, L02 cells, HL-60 cells
Positive IP detected inTHP-1 cells
Positive IHC detected inhuman colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29388-1-AP targets CEBP Alpha/CEBPA in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29947

Product name: Recombinant human CEBPA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-125 aa of NM_004364

Sequence: MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAH

Predict reactive species
Full Name CCAAT/enhancer binding protein (C/EBP), alpha
Calculated Molecular Weight 38 kDa
Observed Molecular Weight 40-45 kDa
GenBank Accession NumberNM_004364
Gene Symbol CEBPA
Gene ID (NCBI) 1050
RRIDAB_3086127
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP49715
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CEBPA and its isoforms play important roles in lineage determination and gene activation in a variety of cell types by activating transcription from lineage-specific promoters. CEBPA is a DNA-binding protein that recognizes two different motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. In hematopoiesis, C/EBPa is a key factor in driving the development of myeloid cells interacting with a variety of factors, including c-Myc, PU.1, and microRNAs. It can also form heterodimers with the related proteins CEBP-beta and CEBP-gamma. The encoded protein has been shown to bind to the promoter and modulate the expression of the gene encoding leptin which plays an important role in body weight homeostasis. CEBPA can interact with CDK2 and CDK4, thereby inhibiting these kinases and causing growth arrest in cultured cells. Several pathways have been implicated as the means by which CEBPA mediates cell cycle arrest and proliferation, including p21, cyclin-dependent kinases and the E2F complex via c-Myc. The calcualted molecular weight of CEBPA is 38 kDa, but modified CEBPA is about 42 kDa (PMID: 19623175).

Protocols

Product Specific Protocols
IF protocol for CEBP Alpha/CEBPA antibody 29388-1-APDownload protocol
IHC protocol for CEBP Alpha/CEBPA antibody 29388-1-APDownload protocol
IP protocol for CEBP Alpha/CEBPA antibody 29388-1-APDownload protocol
WB protocol for CEBP Alpha/CEBPA antibody 29388-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

J Agric Food Chem

Enzymatic Synthesis and Evaluation of Eight Methylated Quercetin Products: In Vitro Chemical Properties and Adipogenesis Regulation

Authors - Beijun Ang
rat,humanWB

Front Pharmacol

Bushen Huoxue formula attenuates lipid accumulation evoking excessive autophagy in premature ovarian insufficiency rats and palmitic acid-challenged KGN cells by modulating lipid metabolism

Authors - Tian Li
WB

J Virol

Dengue virus NS1 leads to downregulation of HNF4 alpha in liver cells resulting in a decrease in coagulation factors I, V, X, and XIII, contributing to coagulopathy

Authors - Sandeepan Das
mouseWB

Toxicol Lett

The Effects of Citalopram and Sertraline on Adipogenesis and Lipogenesis in 3T3-L1 Cells

Authors - Deniz Bozdag
WB

FASEB Bioadv

NPC1L1 Drives Osteoporosis by Activating the C/EBPα/Cyp27a1/27-Hydroxycholesterol Axis: A Novel Therapeutic Target for Bone Loss

Authors - Bohao Li
humanWB

Toxics

Tris (2-chloroisopropyl) phosphate and Tris (nonylphenyl) phosphite Promote Human Renal Cell Apoptosis through the ERK/CEPBA/Long Non-Coding RNA Cytoskeleton Regulator Axis

Authors - Hu Zhao
  • KD Validated
Loading...
||
New chat

Able

正在加载,请稍候...