CEBP Alpha/CEBPA Recombinant monoclonal antibody, PBS Only

CEBP Alpha/CEBPA Uni-rAb® Recombinant Antibody for WB, FC (Intra), Indirect ELISA
Cat No. 84668-2-PBS
Clone No.242101C10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

CEBP alpha, CEBPA, 242101C10, C/EBP alpha, C/EBPα

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84668-2-PBS targets CEBP Alpha/CEBPA in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29947

Product name: Recombinant human CEBPA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-125 aa of NM_004364

Sequence: MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAH

Predict reactive species
Full Name CCAAT/enhancer binding protein (C/EBP), alpha
Calculated Molecular Weight 38 kDa
Observed Molecular Weight 40-45 kDa
GenBank Accession NumberNM_004364
Gene Symbol CEBPA
Gene ID (NCBI) 1050
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP49715
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CEBPA and its isoforms play important roles in lineage determination and gene activation in a variety of cell types by activating transcription from lineage-specific promoters. CEBPA is a DNA-binding protein that recognizes two different motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. In hematopoiesis, C/EBPa is a key factor in driving the development of myeloid cells interacting with a variety of factors, including c-Myc, PU.1, and microRNAs. It can also form heterodimers with the related proteins CEBP-beta and CEBP-gamma. The encoded protein has been shown to bind to the promoter and modulate the expression of the gene encoding leptin which plays an important role in body weight homeostasis. CEBPA can interact with CDK2 and CDK4, thereby inhibiting these kinases and causing growth arrest in cultured cells. Several pathways have been implicated as the means by which CEBPA mediates cell cycle arrest and proliferation, including p21, cyclin-dependent kinases and the E2F complex via c-Myc. The calcualted molecular weight of CEBPA is 38 kDa, but modified CEBPA is about 42 kDa (PMID: 19623175).

Loading...
||
New chat Able
正在加载,请稍候...