CEBPZ Polyclonal antibody

• 

  WB analysis of HeLa using 25612-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 25612-1-AP (CEBPZ Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25612-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25612-1-AP (CEBPZ antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25612-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25612-1-AP (CEBPZ antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 25612-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25612-1-AP (CEBPZ Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 25612-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25612-1-AP (CEBPZ Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 25612-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25612-1-AP (CEBPZ Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 25612-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25612-1-AP (CEBPZ Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 25612-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 25612-1-AP (CEBPZ antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

CEBPZ Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25612-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

CBF, CBF2, CCAAT binding factor, CEBPZ, HSP CBF, NOC1

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse testis tissue, Jurkat cells, K-562 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

25612-1-AP targets CEBPZ in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11003

  Product name: Recombinant human CEBPZ protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 705-1054 aa of BC034475

  Sequence: FCGAENTSLWELKKLSVHFHPSVALFAKTILQGNYIQYSGDPLQDFTLMRFLDRFVYRNPKPHKGKENTDSVVMQPKRKHFIKDIRHLPVNSKEFLAKEESQIPVDEVFFHRYYKKVAVKEKQKRDADEESIEDVDDEEFEELIDTFEDDNCFSSGKDDMDFAGNVKKRTKGAKDNTLDEDSEGSDDELGNLDDDEVSLGSMDDEEFAEVDEDGGTFMDVLDDESESVPELEVHSKVSTKKSKRKGTDDFDFAGSFQGPRKKKRNLNDSSLFVSAEEFGHLLDENMGSKFDNIGMNAMANKDNASLKQLRWEAERDDWLHNRDAKSIIKKKKHFKKKRIKTTQKTKKQRK

• Full Name: CCAAT/enhancer binding protein (C/EBP), zeta
• Calculated Molecular Weight: 1054 aa, 121 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: BC034475
• Gene Symbol: CEBPZ
• Gene ID (NCBI): 10153
• RRID: AB_2880160
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q03701
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CEBPZ (CCAAT/enhancer binding protein zeta) belongs to the CBF/Mak21 family, it plays a role in cellular response to environmental stimuli through a transcriptional process that involves heat shock factors, conserved DNA elements (heat shock elements or HSEs) and CCAAT boxes. The protein acts as a DNA-binding transcriptional activator and regulates the heat-shock protein 70 (HSP70) promoter in a CCAAT-dependent manner.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Sci; CEBPγ facilitates lamellipodia formation and cancer cell migration through CERS6 upregulation.; Authors - Hanxiao Shi
mouse	WB	Mol Cell Proteomics; Characterization of R-Loop-Interacting Proteins in Embryonic Stem Cells Reveals Roles in rRNA Processing and Gene Expression.; Authors - Tong Wu