CENPB Polyclonal antibody

• 

  WB analysis using 26738-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26738-1-AP (CENPB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

CENPB Polyclonal Antibody for WB, ELISA

Cat No. 26738-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

CENP B, CENPB, Centromere protein B, centromere protein B, 80kDa, Major centromere autoantigen B

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26738-1-AP targets CENPB in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24967

  Product name: Recombinant human CENPB protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-180 aa of BC053847

  Sequence: MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASNGWLDRFRRRHGVVSCSGVARARARNAAPRTPAAPASPAAVPSEGSGGSTTGWRAREEQPP

• Full Name: centromere protein B, 80kDa
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC053847
• Gene Symbol: CENPB
• Gene ID (NCBI): 1059
• RRID: AB_3085899
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07199
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Centromere protein B (CENPB), also known as major centromere autoantigen B, is an autoantigen protein of the cell nucleus. In mammalian centromeres CENPB plays a critical role in the organization of chromatinstructure, but in the absence of CENPB some chromosomes use other redundant proteins to accomplish mitosis (PMID: 14963831). CENPB plays an important role in cell cycle regulation. CENPB is highly expressed in cancer cells helping in high rate proliferation. This antibody detects CENPB protein with a molecular weight of 80 kDa (PMID: 34547289, PMID: 29273057).