CENPE Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CENPE Recombinant monoclonal antibody, PBS Only (86805-3-PBS)

CENPE Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86805-3-PBS

Clone No.251614G4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Kinesin 7, CENP E, Centromere associated protein E, Centromere protein E, Kinesin related protein CENPE

• 

  WB analysis using 86805-3-RR (same clone as 86805-3-PBS)

  Jurkat lysates were subjected to SDS PAGE followed by western blot with 86805-3-RR (CENPE antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86805-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 86805-3-RR (same clone as 86805-3-PBS)

  Mouse brain lysates were subjected to SDS PAGE followed by western blot with 86805-3-RR (CENPE antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86805-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 86805-3-RR (same clone as 86805-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CENPE antibody (86805-3-RR, Clone: 251614G4 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86805-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

86805-3-PBS targets CENPE in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27230

  Product name: Recombinant human CENPE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2401-2500 aa of NM_001286734

  Sequence: MESKIIKMQKELEVTNDIIAKLQAKVHESNKCLEKTKETIQVLQDKVALGAKPYKEEIEDLKMKLVKIDLEKMKNAKEFEKEISATKATVEYQKEVIRLLR

• Full Name: centromere protein E, 312kDa
• Calculated Molecular Weight: 316 kDa
• Observed Molecular Weight: 300-316 kDa
• GenBank Accession Number: NM_001286734
• Gene Symbol: CENPE
• Gene ID (NCBI): 1062
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q02224
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Centromeric protein E (CENPE) is also named Kinesin-7. CENPE, a member of the centromere protein (CENP) family, functions as a microtubule plus-end directed motor protein that is upregulated during the G2 phase (PMID: 31115500, PMID: 7851898, PMID: 38560520). It plays a crucial role in the spindle assembly checkpoint (SAC), chromosome alignment, and microtubule capture at kinetochores during mitosis (PMID: 30784092). CENPE is essential for mitotic white matter, which accumulates during the G2 phase of the cell cycle, is consumed throughout mitosis and degrades later in the cell cycle (PMID: 33862458). CENPE regulates the cell cycle by targeting the transcription of CDK1 in the nucleus (PMID: 33862458). Studies on tumor cells have shown that CENPE plays an important role in the regulation of cell proliferation, apoptosis, migration and other activities (PMID: 33862458).