CENPV Polyclonal antibody

• 

  WB analysis using 23005-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23005-1-AP (CENPV antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 23005-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 23005-1-AP (CENPV antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CENPV Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23005-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

centromere protein V, PRR6

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells, L02 cells
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23005-1-AP targets CENPV in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19210

  Product name: Recombinant human CENPV protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-125 aa of BC137486

  Sequence: MRRSRSSAAAKLRGQKRSGASAAPAASAAAALAPSATRTRRSASQAGSKSQAVEKPPSEKPRLRRSSPRAQEEGPGEPPPPELALLPPPPPPPPTPATPTSSASNLDLGEQRERWETFQKRQKLT

• Full Name: centromere protein V
• Calculated Molecular Weight: 275 aa, 30 kDa
• Observed Molecular Weight: 30-33 kDa
• GenBank Accession Number: BC137486
• Gene Symbol: CENPV
• Gene ID (NCBI): 201161
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q7Z7K6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.