CEP120 Monoclonal antibody, PBS Only

• 

  WB analysis using 60468-1-Ig (same clone as 60468-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60468-1-Ig (CEP120 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60468-1-PBS in a different storage buffer formulation.

CEP120 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 60468-1-PBS

Clone No.1G12B4

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

FLJ36090, Coiled-coil domain-containing protein 100, Centrosomal protein of 120 kDa, centrosomal protein 120kDa, CCDC100

---

Product Information

60468-1-PBS targets CEP120 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33947

  Product name: Recombinant human CEP120 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 85-346 aa of BC040527

  Sequence: VTSAKETIGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKSEIQISIALETDTKPPVDSFKAKGAPPRDGKVPAILAGLDPRDIVAVLNEEGGYHQIGPAEYCTDSFIMSVTIAFATQLEQLIPCTMKLPERQPEFFFYYSLLGNDVTNEPFNDLINPNFEPERASVRIRSSVEILRVYLALQSKLQIHLCCGDQSLGSTEIPLTGLLKKGSTEINQHPVTVEGAFTLDPPNRAKQKLAPIPVELAPTVGVSVALQREGIDSQ

• Full Name: centrosomal protein 120kDa
• Calculated Molecular Weight: 986 aa, 113 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC040527
• Gene Symbol: CEP120
• Gene ID (NCBI): 153241
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N960
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CEP120 encodes a protein that functions in the microtubule-dependent coupling of the nucleus and the centrosome. It is involved in regulating centrosome-mediated interkinetic nuclear migration of neural progenitors (PMID: 27185865, 23857771). CEP120, SPICE1, and CPAP are required for centriole elongation and for the recruitment of distal microtubule-capping proteins and CEP135 to procentrioles (PMID: 23810536).