Filter: AllIHCIF/ICC

IHC staining of human prostate cancer using 30446-1-AP (same clone as 30446-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 30446-1-AP (CEP295 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30446-1-PBS in a different storage buffer formulation.
IHC staining of human prostate cancer using 30446-1-AP (same clone as 30446-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 30446-1-AP (CEP295 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30446-1-PBS in a different storage buffer formulation.
IF Staining of U2OS using 30446-1-AP (same clone as 30446-1-PBS)
Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using CEP295 antibody (30446-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 30446-1-PBS in a different storage buffer formulation.

CEP295 Polyclonal antibody, PBS Only

Name: CEP295 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 30446-1-PBS

CEP295 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 30446-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

30446-1-PBS targets CEP295 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag32896 Product name: Recombinant human CEP295 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1877-1978 aa of NM_033395.1 Sequence: LRVSISREQSFFGSPLAHDPFSCLQLVGQENVCGDDYDEAVKLKESVVENHAVLSYAVEEEHAYLGPTVKPDDKAKTLSYEPLSSATVSTGSLLSYENTDLS Predict reactive species
Full Name	KIAA1731
Calculated Molecular Weight	295 kDa
GenBank Accession Number	NM_033395.1
Gene Symbol	CEP295
Gene ID (NCBI)	85459
RRID	AB_3669722
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9C0D2
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™