CEP89, CCDC123 Monoclonal antibody, PBS Only (Capture)

• Home
• Products
• Primary Antibodies
• CEP89, CCDC123 Monoclonal antibody, PBS Only (Capture) (68112-1-PBS)

• 

  WB analysis of Neuro-2a using 68112-1-Ig (same clone as 68112-1-PBS)

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 68112-1-Ig (CCDC123 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68112-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68112-1-Ig (same clone as 68112-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68112-1-Ig (CEP89, CCDC123 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with Lamin B1 Monoclonal antibody (66095-1-Ig) as loading control. This data was developed using the same antibody clone with 68112-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68112-1-Ig (same clone as 68112-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68112-1-Ig (CCDC123 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68112-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse eye using 68112-1-Ig (same clone as 68112-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse eye tissue using CEP89, CCDC123 antibody (68112-1-Ig, Clone: 1F12C5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68112-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse eye using 68112-1-Ig (same clone as 68112-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse eye tissue using CEP89, CCDC123 antibody (68112-1-Ig, Clone: 1F12C5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68112-1-PBS in a different storage buffer formulation.

• 

  IF Staining of hTERT-RPE1 using 68112-1-Ig (same clone as 68112-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed hTERT-RPE1 cells using CEP89, CCDC123 antibody (68112-1-Ig, Clone: 1F12C5 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CoraLite®594 ARL13B antibody (CL594-17711, red). This data was developed using the same antibody clone with 68112-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51731-1

  Cytometric bead array sample test of MP51731-1, CEP89, CCDC123 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68112-1-PBS. Detection antibody: 68112-2-PBS.

• 

  Cytometric bead array standard curve of MP51731-1

  Cytometric bead array standard curve of MP51731-1, CEP89, CCDC123 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68112-1-PBS. Detection antibody: 68112-2-PBS. Standard:Ag28339. Range: 3.125-400 ng/mL.

CEP89, CCDC123 Monoclonal Antibody for WB, IF-P, Cytometric bead array, Indirect ELISA

Cat No. 68112-1-PBS

Clone No.1F12C5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IF-P, Indirect ELISA

Synonyms

CCDC123, CEP89, 1F12C5, Centrosomal protein 123, Centrosomal protein of 89 kDa

---

Product Information

68112-1-PBS targets CEP89, CCDC123 as part of a matched antibody pair:

MP51731-1: 68112-1-PBS capture and 68112-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28339

  Product name: Recombinant human CCDC123 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 248-343 aa of BC136328

  Sequence: MDLNNMNQSLTLELNTMKQAMKELQLKLKGMEKEKRKLKEAEKASSQEVAAPELLYLRKQAQELVDENDGLKMTVHRLNVELSRYQTKFRHLSKEE

• Full Name: coiled-coil domain containing 123
• Calculated Molecular Weight: 783 aa, 90 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC136328
• Gene Symbol: CEP89
• Gene ID (NCBI): 84902
• RRID: AB_2923641
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q96ST8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCDC123 (as known as CEP123), also named as CEP89, encodes for a protein required for ciliogenesis. It plays a role in mitochondrial metabolism by modulating complex IV activity. It has been shown that CEP123 is localized to the distal appendages of the mother centriolecep and the localization of CEP123 is cell cycle-dependent with its levels decreasing during mitosis. CEP123 depletion can cause defects in ciliary vesicle formationcep and prevent the formation of a ciliary vesicle at the distal end of the mother centriole. It is possible that CEP123 is involved in regulating the recruitment of membranes to the centrosome through its interaction with CEP290 (PMID:23575228, 23789104, 23348840).