CEP89, CCDC123 Monoclonal antibody, PBS Only

CEP89, CCDC123 Monoclonal Antibody for WB, IF-P, Indirect ELISA
Cat No. 68112-1-PBS
Clone No.1F12C5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IF-P, Indirect ELISA

CEP89, CCDC123, 1F12C5, Cep123, Centrosomal protein of 89 kDa

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68112-1-PBS targets CEP89, CCDC123 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28339

Product name: Recombinant human CCDC123 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 248-343 aa of BC136328

Sequence: MDLNNMNQSLTLELNTMKQAMKELQLKLKGMEKEKRKLKEAEKASSQEVAAPELLYLRKQAQELVDENDGLKMTVHRLNVELSRYQTKFRHLSKEE

Predict reactive species
Full Name coiled-coil domain containing 123
Calculated Molecular Weight 783 aa, 90 kDa
Observed Molecular Weight90 kDa
GenBank Accession NumberBC136328
Gene Symbol CEP89
Gene ID (NCBI) 84902
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ96ST8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CCDC123 (as known as CEP123), also named as CEP89, encodes for a protein required for ciliogenesis. It plays a role in mitochondrial metabolism by modulating complex IV activity. It has been shown that CEP123 is localized to the distal appendages of the mother centriolecep and the localization of CEP123 is cell cycle-dependent with its levels decreasing during mitosis. CEP123 depletion can cause defects in ciliary vesicle formationcep and prevent the formation of a ciliary vesicle at the distal end of the mother centriole. It is possible that CEP123 is involved in regulating the recruitment of membranes to the centrosome through its interaction with CEP290 (PMID:23575228, 23789104, 23348840).

Loading...
||
New chat

Able

正在加载,请稍候...