Centrin 2 Polyclonal antibody

• 

  WB analysis using 15877-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 15877-1-AP (Centrin 2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 15877-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15877-1-AP (Centrin 2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 15877-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15877-1-AP (Centrin 2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Centrin 2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15877-1-AP

Publications(15)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

CALT, Caltractin isoform 1, CEN2, Centrin 2, centrin 2,centrin2, centrin, EF hand protein, 2, CETN2

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, rat brain tissue, mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 8 publications below
• IF: See 8 publications below

Product Information

15877-1-AP targets Centrin 2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8638

  Product name: Recombinant human Centrin 2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-172 aa of BC005334

  Sequence: MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY

• Full Name: centrin, EF-hand protein, 2
• Calculated Molecular Weight: 172 aa, 20 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC005334
• Gene Symbol: Centrin 2
• Gene ID (NCBI): 1069
• RRID: AB_2077383
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P41208
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Centrin 2 is also named as CALT, or CEN2. It plays a fundamental role in microtubule-organizing center structure and function. Oxidizing radiation induces polymerization of centrin 2 into dimers, tetramers, hexamers,and even higher molecular mass species, as a function of the radiation dose(PMID:17603931).It exsits as a 21-kD polypeptide specifically localized to the centrosome of interphase and mitotic cells in both HeLa and BHK cells (PMID:8248209).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; A DNA repair complex functions as an Oct4/Sox2 coactivator in embryonic stem cells.; Authors - Fong Yick W YW
mouse	IF	Cell Res; NudCL2 is an autophagy receptor that mediates selective autophagic degradation of CP110 at mother centrioles to promote ciliogenesis.; Authors - Min Liu
mouse	WB	J Clin Invest; USP44 regulates centrosome positioning to prevent aneuploidy and suppress tumorigenesis.; Authors - Zhang Ying Y
human	WB	Genes Dev; Regulation of DNA demethylation by the XPC DNA repair complex in somatic and pluripotent stem cells.; Authors - Jaclyn J Ho
human	WB	Proc Natl Acad Sci U S A; Functional and mechanistic studies of XPC DNA-repair complex as transcriptional coactivator in embryonic stem cells.; Authors - Claudia Cattoglio
mouse		Elife; The dyskerin ribonucleoprotein complex as an OCT4/SOX2 coactivator in embryonic stem cells.; Authors - Yick W Fong