CFAP47 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CFAP47 Polyclonal antibody (30579-1-AP)

• 

  WB analysis using 30579-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30579-1-AP (CFAP47 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 30579-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 30579-1-AP (CFAP47 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 30579-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 30579-1-AP (CFAP47 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 30579-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 30579-1-AP (CFAP47 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 30579-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 30579-1-AP (CFAP47 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of hTERT-RPE1 using 30579-1-AP

  Immunofluorescent analysis of (4% PFA) fixed hTERT-RPE1 cells using CFAP47 antibody (30579-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

CFAP47 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 30579-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CXorf59, Cilia and flagella associated protein 47

---

Tested Applications

• Positive WB detected in: MRC-5 cells, human testis tissue, mouse spermatophore tissue
• Positive IHC detected in: mouse testis tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: hTERT-RPE1 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30579-1-AP targets CFAP47 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31679

  Product name: Recombinant human CXorf59 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC101700

  Sequence: MAIHLDKQNIILKNDKDEYLKKTRDGVLPPYQDAKPPSPASIKKTYTTSKFNDAEPAKGNLFIGVEVLPENLHLDESETSEEDHGSLEKEKYEQFLSLEEGTKAHYFFEKVVNAAQTWFSLFGWPEGPHSFSIPETIRRDVYKMQFYSSTSPPQKFSRQNDFSKYNKTIYDVLLHLSGKMPPGINSSQSLPVDNHEKRVIQLHLQHSSLLDFLNAQGGCISHVLPEFLLEPEDYKRWIEIMSSTNTMPVSSCTPKKKCSIVIEMSKFEAWSKRAWTDVFLQIYKVLVLSRVVPYCSNNMPPICVQNTPKVNPCFASSNIYSDSERILLSWMNINYENTRHVIWKNCHKDVI

• Full Name: chromosome X open reading frame 59
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC101700
• Gene Symbol: CXorf59
• Gene ID (NCBI): 286464
• RRID: AB_3742352
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZTR5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CFAP47 (Cilia- and flagella-associated protein 47), formerly known as CXorf22, CXorf59, is located on the human chromosome X and highly expressed in the testis and encodes a cilia- and flagella-associated protein. CFAP47 was expressed in primary cilia of human kidney tubules, and knockout (KO) mice exhibited vacuolation of tubular cells and tubular dilation, providing evidence that CFAP47 is a causative gene involved in cyst formation (PMID: 33472045, 38633811). CFAP47-mutated male mice are sterile, with decreased sperm motility and abnormal flagella morphology (PMID: 37424856).