CFAP70 Polyclonal antibody

• 

  IP experiment of mouse testis using 31344-1-AP

  IP result of anti-CFAP70 (IP:31344-1-AP, 4ug; Detection:31344-1-AP 1:300) with mouse testis tissue lysate 1120 ug.

• 

  IHC staining of rat testis using 31344-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 31344-1-AP (CFAP70 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 31344-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 31344-1-AP (CFAP70 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse testis using 31344-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using CFAP70 antibody (31344-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CFAP70 Polyclonal Antibody for IHC, IF-P, IP, ELISA

Cat No. 31344-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, IP, ELISA

Synonyms

TTC18, TPR repeat protein 18

---

Tested Applications

• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: rat testis tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31344-1-AP targets CFAP70 in IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35209

  Product name: Recombinant human TTC18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC032856

  Sequence: MEQVPSAGRLVQITVTEGYDLKGFKGDTPVTFIRAEFNQVVLGDSAKITVSPEGSAKYNFTSSFEFNPEGGITSDDLAHKPVFLTVTEVLPKEKKQKEEKTLILGQAVVDLLPLLEGQSSFQTTVPLHPVQGSPLETPRSSAKQCSLEVKVLVAEPLLTTAQISGGNLLKVTLEAAYSVPESFIPTGPGQNYMVGLQVPS

• Full Name: tetratricopeptide repeat domain 18
• Calculated Molecular Weight: 126 kDa
• Observed Molecular Weight: 126 kDa
• GenBank Accession Number: BC032856
• Gene Symbol: TTC18
• Gene ID (NCBI): 118491
• RRID: AB_3669954
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T0N1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cilia- and flagella-associated protein 70 (CFAP70) harbours eight tetratricopeptide repeats (TPRs) and bound tightly to the ciliary axoneme. CFAP70 is necessary to assemble spermatid flagella and could be used as a diagnostic target for male infertility with OAT in the clinic.CFAP70 is a novel regulatory component of the ODA in motile cilia and flagella, and that the N-terminus is important for its ciliary localization (PMID: 30158508).