Properdin/PFC Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of human plasma using 85999-1-RR (same clone as 85999-1-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 85999-1-RR (Properdin/PFC antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85999-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 85999-1-RR (same clone as 85999-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85999-1-RR (Properdin/PFC antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85999-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85999-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85999-1-RR against Human CFP were performed. The affinity constant is 0.98 nM.

Properdin/PFC Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85999-1-PBS

Clone No.250654E3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

CFP, BFD, Complement factor P, complement factor properdin, PFC

---

Product Information

85999-1-PBS targets Properdin/PFC in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2219

  Product name: Recombinant Human CFP protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*His

  Domain: 28-469 aa of BC015756

  Sequence: DPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL

• Full Name: complement factor properdin
• Calculated Molecular Weight: 469 aa, 51 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC015756
• Gene Symbol: CFP
• Gene ID (NCBI): 5199
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P27918
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CFP, also named as Properdin or PFC, is a 469 amino acid protein, which contains 7 TSP type-1 domains. CFP as secreted protein is a positive regulator of the alternate pathway of complement. It binds to and stabilizes the C3- and C5-convertase enzyme complexes. Properdin deficiency poses a significant risk for severe meningococcal infections (PMID: 22229731). Properdin may be novel biomarker for future risk of type 2 diabetes (PMID: 22338105).