CGGBP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CGGBP1 Polyclonal antibody, PBS Only (10716-1-PBS)

• 

  WB analysis using 10716-1-AP (same clone as 10716-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10716-1-AP (CGGBP1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10716-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse thymus using 10716-1-AP (same clone as 10716-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 10716-1-AP (CGGBP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10716-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 10716-1-AP (same clone as 10716-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 10716-1-AP (CGGBP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10716-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 10716-1-AP (same clone as 10716-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 10716-1-AP (CGGBP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10716-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 10716-1-AP (same clone as 10716-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 10716-1-AP (CGGBP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10716-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10716-1-AP (same clone as 10716-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10716-1-AP (CGGBP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10716-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CGGBP1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10716-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

10716-1-PBS targets CGGBP1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1129

  Product name: Recombinant human CGGBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-167 aa of BC005222

  Sequence: MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRTYLPDGYENENQLLNSQDC

• Full Name: CGG triplet repeat binding protein 1
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 19-23 kDa
• GenBank Accession Number: BC005222
• Gene Symbol: CGGBP1
• Gene ID (NCBI): 8545
• RRID: AB_2079283
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UFW8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CGGBP1, also named as CGGBP, is a 20 kDa CGG-binding protein. It binds to nonmethylated 5'-d(CGG)(n)-3' trinucleotide repeats in the FMR1 promoter. CGGBP1 may play a role in regulating FMR1 promoter. It is a bona fide midbody protein required for normal abscission and mitosis in general.(PMID:20832400)